Powered by Bioz
Streptavidin (Cat. No. 2-0208-xxx) replaces Streptavidin (Cat. No. 2-0203-xxx) since January 2026. Compared to the previous Streptavidin (Cat. No. 2-0203-xxx), the new Streptavidin (Cat. No. 2-0208-xxx) is characterized by higher purity and low endotoxin content.
Streptavidin is a tetrameric protein composed of identic subunits. Each subunit specifically binds one biotin molecule with fM affinity, which makes it one of the strongest non-covalent interactions known. The preparation contains an N- and C-terminal shortened variant (core streptavidin) with improved properties regarding homogeneity, solubility, resistance towards proteolytic degradation, and accessibility of the biotin binding pocket as compared to native streptavidin.
The streptavidin:biotin system is widely used for immobilization and detection of biotinylated molecules, like proteins and nucleic acids.
The product is animal component free (ACF) & animal origin free (AOF) and without any affinity tag.
IBA Lifesciences provides bulk amounts of lyophilized streptavidin in reliable and high quality at competitive prices to generate streptavidin-coated surfaces (microplates, SPR chips, beads) or detection reagents conjugated with, e.g., fluorescent dyes. Please note that streptavidin is not applicable for detection, immobilization, and purification of Strep-tag®II and Twin-Strep-tag® fusion proteins, since the binding affinity for both tags is too low.
For bulk order please get in contact: strep-tag@iba-lifesciences.com
| Form: | Lyophilized powder |
|---|---|
| Possible Application: | Coating of surfaces |
| Purity: | > 95% determined by SEC |
| Reconstitution: | Water |
| Sequence: | MEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS |
| Size: | 13.3 kDa per subunit |
| Source: | Recombinant, expression in E. coli |
| Specific Activity: | > 17 U/mg |
| Storage: | -20 °C |
| Stability: | 24 months after shipping |
| Shipping: | Room temperature |
Related Products
Strep-Tactin®
Reversible immobilization of biotinylated analytes or Strep-tag®II and Twin-Strep-tag® fusion proteins
